Structure of PDB 1gp7 Chain C |
>1gp7C (length=124) Species: 8665 (Ophiophagus hannah) [Search protein sequence] |
HLIQFGNMIQCTVPGFLSWIKYADYGCYCGAGGSGTPVDKLDRCCQVHDN CYTQAQKLPACSSIMDSPYVKIYSYDCSERTVTCKADNDECAAFICNCDR VAAHCFAASPYNNNNYNIDTTTRC |
|
PDB | 1gp7 Structure of a Cardiotoxic Phospholipase A(2) from Ophiophagus Hannah with the "Pancreatic Loop" |
Chain | C |
Resolution | 2.6 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
C |
Y28 G30 G32 D49 |
Y28 G30 G32 D49 |
|
|
|
|