Structure of PDB 1g73 Chain C |
>1g73C (length=89) Species: 9606 (Homo sapiens) [Search protein sequence] |
LPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGG GLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHL |
|
PDB | 1g73 Structural basis of IAP recognition by Smac/DIABLO. |
Chain | C |
Resolution | 2.0 Å |
3D structure |
|
|
Enzyme Commision number |
2.3.2.27: RING-type E3 ubiquitin transferase. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
C |
C300 C303 H320 C327 |
C45 C48 H65 C72 |
|
|
|