Structure of PDB 1g0o Chain C

Receptor sequence

>1g0oC (length=281) Species: 148305 (Pyricularia grisea)

AVTQPRGESKYDAIPGPLGPQSASLEGKVALVTGAGRGIGREMAMELGRR
GCKVIVNYANSTESAEEVVAAIKKNGSDAACVKANVGVVEDIVRMFEEAV
KIFGKLDIVCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKH
LEIGGRLILMGSITGQAKAVPKHAVYSGSKGAIETFARCMAIDMADKKIT
VNVVAPGGIKTDMYHAVCREYIPNGENLSNEEVDEYAAVQWSPLRRVGLP
IDIARVVCFLASNDGGWVTGKVIGIDGGACM

3D structure

• PDB: 1g0o Structures of trihydroxynaphthalene reductase-fungicide complexes: implications for structure-based design and catalysis.
• Chain: C
• Resolution: 1.7 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): G40 S164 H175 Y178 K182 Y223
• Catalytic site (residue number reindexed from 1): G38 S162 H173 Y176 K180 Y221
• Enzyme Commision number: 1.1.1.252: tetrahydroxynaphthalene reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NDP	C	G36 R39 G40 I41 A61 N62 S63 N87 V88 N114 S115 G116 M162 Y178 K182 P208 G210 I211 T213 M215	G34 R37 G38 I39 A59 N60 S61 N85 V86 N112 S113 G114 M160 Y176 K180 P206 G208 I209 T211 M213
BS02	PYQ	C	S164 I165 Y178 G210 Y223	S162 I163 Y176 G208 Y221	MOAD: Ki=14nM

Gene Ontology

Molecular Function

• GO:0016491 oxidoreductase activity
• GO:0047039 tetrahydroxynaphthalene reductase activity

Biological Process

• GO:0042438 melanin biosynthetic process

Cellular Component

• GO:0005575 cellular_component

External links

• PDB: RCSB:1g0o, PDBe:1g0o, PDBj:1g0o
• PDBsum: 1g0o
• PubMed: 11342131
• UniProt: Q12634|T4HR_PYRO7 Tetrahydroxynaphthalene reductase (Gene Name=MGG_02252)