Structure of PDB 1g0a Chain C

Receptor sequence

>1g0aC (length=141) Species: 9913 (Bos taurus)

VLSAADKGNVKAAWGKVGGHAAEYGAEALERMFLSFPTTKTYFPHFDLSH
GSAQVKGHGAKVAAALTKAVEHLDDLPGALSELSDLHAHKLRVDPVNFKL
LSHSLLVTLASHLPSDFTPAVHASLDKFLANVSTVLTSKYR

3D structure

• PDB: 1g0a Interface sliding as illustrated by the multiple quaternary structures of liganded hemoglobin.
• Chain: C
• Resolution: 2.04 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	C	Y42 F43 H45 H58 K61 L86 H87 L91 N97 F98 L101 L136	Y42 F43 H45 H58 K61 L86 H87 L91 N97 F98 L101 L136

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0005506 iron ion binding
• GO:0005515 protein binding
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0031720 haptoglobin binding
• GO:0043177 organic acid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015671 oxygen transport
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005833 hemoglobin complex
• GO:0031838 haptoglobin-hemoglobin complex

External links

• PDB: RCSB:1g0a, PDBe:1g0a, PDBj:1g0a
• PDBsum: 1g0a
• PubMed: 11112521
• UniProt: P01966|HBA_BOVIN Hemoglobin subunit alpha (Gene Name=HBA)