Structure of PDB 1fqk Chain C

Receptor sequence

>1fqkC (length=317) Species: 9913,10116

TVKLLLLGAGESGKSTIVKQMKIIHQDGYSLEECLEFIAIIYGNTLQSIL
AIVRAMTTLNIQYGDSARQDDARKLMHMADTIEEGTMPKEMSDIIQRLWK
DSGIQACFDRASEYQLNDSAGYYLSDLERLVTPGYVPTEQDVLRSRVKTT
GIIETQFSFKDLNFRMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDL
VLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSP
LTICYPEYAGSNTYEEAGNYIKVQFLELNMRRDVKEIYSHMTCATDTQNV
KFVFDAVTDIIIKENLK

3D structure

• PDB: 1fqk Structural determinants for regulation of phosphodiesterase by a G protein at 2.0 A.
• Chain: C
• Resolution: 2.3 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E39 T44 R174 D196 Q200
• Catalytic site (residue number reindexed from 1): E11 T16 R146 D168 Q172

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	C	S43 T177	S15 T149
BS02	ALF	C	G38 E39 K42 R174 K176 T177 G199 Q200	G10 E11 K14 R146 K148 T149 G171 Q172
BS03	GDP	C	E39 S40 G41 K42 S43 T44 D146 L171 R172 R174 N265 K266 D268 L269 C321 A322 T323	E11 S12 G13 K14 S15 T16 D118 L143 R144 R146 N237 K238 D240 L241 C293 A294 T295

Gene Ontology

Molecular Function

• GO:0003924 GTPase activity
• GO:0005525 GTP binding
• GO:0019001 guanyl nucleotide binding
• GO:0031683 G-protein beta/gamma-subunit complex binding

Biological Process

• GO:0007165 signal transduction
• GO:0007186 G protein-coupled receptor signaling pathway
• GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway

External links

• PDB: RCSB:1fqk, PDBe:1fqk, PDBj:1fqk
• PDBsum: 1fqk
• PubMed: 11234020
• UniProt: P04695|GNAT1_BOVIN Guanine nucleotide-binding protein G(t) subunit alpha-1 (Gene Name=GNAT1);
  P10824|GNAI1_RAT Guanine nucleotide-binding protein G(i) subunit alpha-1 (Gene Name=Gnai1)