Structure of PDB 1fdu Chain C

Receptor sequence

>1fduC (length=285) Species: 9606 (Homo sapiens)

ARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAAR
ALACPPGSLETLQLDVRDSKSVAAARERVTEGRVDVLVCNAGLGLLGPLE
ALGEDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSVGGLMGLP
FNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEKVLGSP
EEVLDRTDIHTFHRFYQYLALSKQVFREAAQNPEEVAEVFLTALRAPKPT
LRYFTTERFLPLLRMRLDDPSGSNYVTAMHREVFG

3D structure

• PDB: 1fdu Unusual charge stabilization of NADP+ in 17beta-hydroxysteroid dehydrogenase.
• Chain: C
• Resolution: 2.7 Å

Enzymatic activity

• Enzyme Commision number: 1.1.1.51: 3(or 17)beta-hydroxysteroid dehydrogenase.
  1.1.1.62: 17beta-estradiol 17-dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	EST	C	S142 V143 G144 L149 Y155 G186 P187 F259 M279	S142 V143 G144 L149 Y155 G186 P187 F259 M279
BS02	NAP	C	G9 S11 S12 G13 I14 R37 D65 V66 R67 N90 A91 T140 S142 K159 C185 P187 V188 T190 F192 K195 F226	G9 S11 S12 G13 I14 R37 D65 V66 R67 N90 A91 T140 S142 K159 C185 P187 V188 T190 F192 K195 F226

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0004303 estradiol 17-beta-dehydrogenase [NAD(P)+] activity
• GO:0005496 steroid binding
• GO:0005515 protein binding
• GO:0016491 oxidoreductase activity
• GO:0030283 testosterone dehydrogenase [NAD(P)+] activity
• GO:0036094 small molecule binding
• GO:0042803 protein homodimerization activity
• GO:0047035 testosterone dehydrogenase (NAD+) activity
• GO:0047045 testosterone 17-beta-dehydrogenase (NADP+) activity
• GO:0050661 NADP binding
• GO:0070401 NADP+ binding
• GO:0072582 17-beta-hydroxysteroid dehydrogenase (NADP+) activity
• GO:1903924 estradiol binding

Biological Process

• GO:0006629 lipid metabolic process
• GO:0006694 steroid biosynthetic process
• GO:0006703 estrogen biosynthetic process
• GO:0007040 lysosome organization
• GO:0007519 skeletal muscle tissue development
• GO:0008210 estrogen metabolic process
• GO:0010467 gene expression
• GO:0060348 bone development
• GO:0060612 adipose tissue development
• GO:0061370 testosterone biosynthetic process
• GO:0071248 cellular response to metal ion

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:1fdu, PDBe:1fdu, PDBj:1fdu
• PDBsum: 1fdu
• PubMed: 9525918
• UniProt: P14061|DHB1_HUMAN 17-beta-hydroxysteroid dehydrogenase type 1 (Gene Name=HSD17B1)