Structure of PDB 1f66 Chain C

Receptor sequence
>1f66C (length=103) Species: 9606 (Homo sapiens) [Search protein sequence]
AVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEV
LELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHK
SLI
3D structure
PDB1f66 Crystal structure of a nucleosome core particle containing the variant histone H2A.Z.
ChainC
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C S818 R819 R831 R834 R845 R880 S3 R4 R16 R19 R30 R65
BS02 dna C R831 K837 R845 G847 A848 V878 K879 R880 R16 K22 R30 G32 A33 V63 K64 R65
BS03 MN C H912 H914 H97 H99
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000979 RNA polymerase II core promoter sequence-specific DNA binding
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0031490 chromatin DNA binding
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0031507 heterochromatin formation
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0071392 cellular response to estradiol stimulus
Cellular Component
GO:0000786 nucleosome
GO:0000791 euchromatin
GO:0000792 heterochromatin
GO:0001740 Barr body
GO:0005634 nucleus
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1f66, PDBe:1f66, PDBj:1f66
PDBsum1f66
PubMed11101893
UniProtP0C0S5|H2AZ_HUMAN Histone H2A.Z (Gene Name=H2AZ1)

[Back to BioLiP]