Structure of PDB 1f56 Chain C |
>1f56C (length=91) Species: 3562 (Spinacia oleracea) [Search protein sequence] |
AVYNIGWSFNVNGARGKSFRAGDVLVFKYIKGQHNVVAVNGRGYASCSAP RGARTYSSGQDRIKLTRGQNYFICSFPGHCGGGMKIAINAK |
|
PDB | 1f56 Crystal structure of plantacyanin, a basic blue cupredoxin from spinach. |
Chain | C |
Resolution | 2.05 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU1 |
C |
H34 C74 H79 M84 |
H34 C74 H79 M84 |
|
|
|
|