Structure of PDB 1f1g Chain C

Receptor sequence
>1f1gC (length=153) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
VQAVAVLKGDAGVSGVVKFEQASESEPTTVSYEIAGNSPNAERGFHIHEF
GDATNGCVSAGPHFNPFKKTHGAPTDEVRHVGDMGNVKTDENGVAKGSFK
DSLIKLIGPTSVVGRSVVIHAGQDDLGKGDTEESLKTGNAGPRPACGVIG
LTN
3D structure
PDB1f1g A structure-based mechanism for copper-zinc superoxide dismutase.
ChainC
Resolution1.35 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.15.1.1: superoxide dismutase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CU C H356 H358 H430 H46 H48 H120
BS02 ZN C H373 H381 H390 D393 H63 H71 H80 D83
Gene Ontology
Molecular Function
GO:0004784 superoxide dismutase activity
GO:0005507 copper ion binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0016209 antioxidant activity
GO:0016491 oxidoreductase activity
GO:0016670 oxidoreductase activity, acting on a sulfur group of donors, oxygen as acceptor
GO:0046872 metal ion binding
Biological Process
GO:0006801 superoxide metabolic process
GO:0006878 intracellular copper ion homeostasis
GO:0006882 intracellular zinc ion homeostasis
GO:0015680 protein maturation by copper ion transfer
GO:0019430 removal of superoxide radicals
GO:0031505 fungal-type cell wall organization
GO:0034599 cellular response to oxidative stress
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0050821 protein stabilization
GO:1901856 negative regulation of cellular respiration
GO:1990748 cellular detoxification
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005758 mitochondrial intermembrane space
GO:0005829 cytosol
GO:1902693 superoxide dismutase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1f1g, PDBe:1f1g, PDBj:1f1g
PDBsum1f1g
PubMed10026301
UniProtP00445|SODC_YEAST Superoxide dismutase [Cu-Zn] (Gene Name=SOD1)

[Back to BioLiP]