Structure of PDB 1ezv Chain C

Receptor sequence

>1ezvC (length=385) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

MAFRKSNVYLSLVNSYIIDSPQPSSINYWWNMGSLLGLCLVIQIVTGIFM
AMHYSSNIELAFSSVEHIMRDVHNGYILRYLHANGASFFFMVMFMHMAKG
LYYGSYRSPRVTLWNVGVIIFTLTIATAFLGYCCVYGQMSHWGATVITNL
FSAIPFVGNDIVSWLWGGFSVSNPTIQRFFALHYLVPFIIAAMVIMHLMA
LHIHGSSNPLGITGNLDRIPMHSYFIFKDLVTVFLFMLILALFVFYSPNT
LGHPDNYIPGNPLVTPASIVPEWYLLPFYAILRSIPDKLLGVITMFAAIL
VLLVLPFTDRSVVRGNTFKVLSKFFFFIFVFNFVLLGQIGACHVEVPYVL
MGQIATFIYFAYFLIIVPVISTIENVLFYIGRVNK

3D structure

PDB

1ezv Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment.

Chain

Resolution

2.3 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	H202 S206 K228 D229 E272
Catalytic site (residue number reindexed from 1)	H202 S206 K228 D229 E272
Enzyme Commision number	7.1.1.8: quinol--cytochrome-c reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	HEM	C	Q43 G47 M50 R79 H82 A83 T127 G131 Y132 V135 H183 Y184 P187	Q43 G47 M50 R79 H82 A83 T127 G131 Y132 V135 H183 Y184 P187
BS02	HEM	C	W30 G33 L36 M93 H96 M97 K99 S105 L113 W114 G117 V118 I120 V194 H197 L201 S206 S207	W30 G33 L36 M93 H96 M97 K99 S105 L113 W114 G117 V118 I120 V194 H197 L201 S206 S207
BS03	SMA	C	I125 F129 V146 I269 P271 E272 Y279 M295	I125 F129 V146 I269 P271 E272 Y279 M295
BS04	UQ6	C	Q22 L40 F49 L201 S206 M221	Q22 L40 F49 L201 S206 M221

Gene Ontology

	Molecular Function
GO:0008121	ubiquinol-cytochrome-c reductase activity
GO:0009055	electron transfer activity
GO:0016491	oxidoreductase activity
GO:0046872	metal ion binding

	Biological Process
GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c
GO:0009060	aerobic respiration
GO:0022904	respiratory electron transport chain
GO:0045333	cellular respiration
GO:1902600	proton transmembrane transport

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0016020	membrane
GO:0045275	respiratory chain complex III

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1ezv, PDBe:1ezv, PDBj:1ezv
PDBsum	1ezv
PubMed	10873857
UniProt	P00163\|CYB_YEAST Cytochrome b (Gene Name=COB)

[Back to BioLiP]