Structure of PDB 1eyg Chain C

Receptor sequence

>1eygC (length=112) Species: 562 (Escherichia coli)

ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKE
QTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTE
VVVNVGGTMQML

3D structure

• PDB: 1eyg Structure of the DNA binding domain of E. coli SSB bound to ssDNA.
• Chain: C
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	C	A3001 S3002 N3013 Q3016 T3033 A3035 E3038 S3039 W3040 Q3051 T3052 W3054 H3055 R3056 V3058 F3060 K3073 G3074 Q3076 Q3082 R3084 T3085 R3086 W3088 Y3097 T3098 E3100 V3102 N3104 V3105 G3106	A1 S2 N13 Q16 T33 A35 E38 S39 W40 Q51 T52 W54 H55 R56 V58 F60 K73 G74 Q76 Q82 R84 T85 R86 W88 Y97 T98 E100 V102 N104 V105 G106

Gene Ontology

Molecular Function

• GO:0003697 single-stranded DNA binding

Biological Process

• GO:0006260 DNA replication

External links

• PDB: RCSB:1eyg, PDBe:1eyg, PDBj:1eyg
• PDBsum: 1eyg
• PubMed: 10932248
• UniProt: P0AGE0|SSB_ECOLI Single-stranded DNA-binding protein (Gene Name=ssb)