Structure of PDB 1evw Chain C

Receptor sequence
>1evwC (length=162) Species: 5791 (Physarum polycephalum) [Search protein sequence]
ALTNAQILAVIDSWEETVGQFPVITHHVPLGGGLQGTLHCYEIPLAAPYG
VGFAKNGPTRWQYKRTINQVVHRWGSHTVPFLLEPDNINGKTCTASHLCH
NTRCHNPLHLCWESADDNKGRNWCPGPNGGCVHAVVCLRQGPLYGPGATV
AGPQQRGSHFVV
3D structure
PDB1evw Conformational changes and cleavage by the homing endonuclease I-PpoI: a critical role for a leucine residue in the active site.
ChainC
Resolution3.1 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) N119
Catalytic site (residue number reindexed from 1) N118
Enzyme Commision number 3.1.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C A48 P49 G51 V52 G53 K56 N57 K65 R66 A47 P48 G50 V51 G52 K55 N56 K64 R65 PDBbind-CN: Kd=10pM
BS02 dna C R61 Q63 R74 T79 T95 A96 H98 N119 R60 Q62 R73 T78 T94 A95 H97 N118 PDBbind-CN: Kd=10pM
BS03 MG C H101 N119 H100 N118
BS04 ZN C C125 H134 C138 C124 H133 C137
BS05 ZN C C41 C100 C105 H110 C40 C99 C104 H109
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006314 intron homing

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1evw, PDBe:1evw, PDBj:1evw
PDBsum1evw
PubMed10891275
UniProtQ94702|PPO1_PHYPO Intron-encoded endonuclease I-PpoI

[Back to BioLiP]