Structure of PDB 1eqz Chain C

Receptor sequence
>1eqzC (length=107) Species: 9031 (Gallus gallus) [Search protein sequence]
APATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDF
KTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLAR
RIRGERA
3D structure
PDB1eqz Asymmetries in the nucleosome core particle at 2.5 A resolution.
ChainC
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C Y41 R42 T45 R63 R72 R83 F84 Q85 R116 V117 T118 Y13 R14 T17 R35 R44 R55 F56 Q57 R88 V89 T90
BS02 dna C R40 Y41 G44 V46 A47 R49 R63 K64 L65 R69 R83 R12 Y13 G16 V18 A19 R21 R35 K36 L37 R41 R55
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003682 chromatin binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0010467 gene expression
Cellular Component
GO:0000785 chromatin
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1eqz, PDBe:1eqz, PDBj:1eqz
PDBsum1eqz
PubMed11092917
UniProtP84229|H32_CHICK Histone H3.2 (Gene Name=H3-I)

[Back to BioLiP]