Structure of PDB 1eqb Chain C

Receptor sequence

>1eqbC (length=417) Species: 562 (Escherichia coli) [Search protein sequence]

MLKREMNIADYDAELWQAMEQEKVRQEEHIELIASENYTSPRVMQAQGSQ
LTNKYAEGYPGKRYFGGCEYVDIVEQLAIDRAKELFGADYANVQPHSGSQ
ANFAVYTALLEPGDTVLGMNLAHGGHLTHGSPVNFSGKLYNIVPYGIDAT
GHIDYADLEKQAKEHKPKMIIGGFSAYSGVVDWAKMREIADSIGAYLFVD
MAHVAGLVAAGVYPNPVPHAHVVTTTTHKTLAGPRGGLILAKGGSEELYK
KLNSAVFPGGQGGPLMHVIAGKAVALKEAMEPEFKTYQQQVAKNAKAMVE
VFLERGYKVVSGGTDNHLFLVDLVDKNLTGKEADAALGRANITVNKNSVP
NDPKSPFVTSGIRVGTPAITRRGFKEAEAKELAGWMCDVLDSINDEAVIE
RIKGKVLDICARYPVYA

3D structure

PDB

1eqb Role of tyrosine 65 in the mechanism of serine hydroxymethyltransferase.

Chain

Resolution

2.7 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	Y55 E57 D200 T226 K229 R235
Catalytic site (residue number reindexed from 1)	Y55 E57 D200 T226 K229 R235
Enzyme Commision number	2.1.2.1: glycine hydroxymethyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	GLY	C	S35 H203 K229 R363	S35 H203 K229 R363
BS02	PLP	C	S97 G98 S99 H126 F174 S175 D200 H203 H228 K229	S97 G98 S99 H126 F174 S175 D200 H203 H228 K229
BS03	FFO	C	L121 G124 G125 H126 L127 S175 N347 S355 P356 F357	L121 G124 G125 H126 L127 S175 N347 S355 P356 F357
BS04	GLY	C	Y55 F65	Y55 F65
BS05	FFO	C	E57 Y64	E57 Y64

Gene Ontology

	Molecular Function
GO:0003824	catalytic activity
GO:0004372	glycine hydroxymethyltransferase activity
GO:0005515	protein binding
GO:0008270	zinc ion binding
GO:0008732	L-allo-threonine aldolase activity
GO:0016740	transferase activity
GO:0030170	pyridoxal phosphate binding
GO:0042802	identical protein binding
GO:0042803	protein homodimerization activity

	Biological Process
GO:0006545	glycine biosynthetic process
GO:0006546	glycine catabolic process
GO:0006564	L-serine biosynthetic process
GO:0006565	L-serine catabolic process
GO:0006730	one-carbon metabolic process
GO:0008652	amino acid biosynthetic process
GO:0019264	glycine biosynthetic process from serine
GO:0035999	tetrahydrofolate interconversion
GO:0046653	tetrahydrofolate metabolic process

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1eqb, PDBe:1eqb, PDBj:1eqb
PDBsum	1eqb
PubMed	10858298
UniProt	P0A825\|GLYA_ECOLI Serine hydroxymethyltransferase (Gene Name=glyA)

[Back to BioLiP]