Structure of PDB 1egc Chain C

Receptor sequence

>1egcC (length=387) Species: 9606 (Homo sapiens) [Search protein sequence]

LGFSFEFTEQQKEFQATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWEL
GLMNTHIPENCGGLGLGTFDACLISEELAYGCTGVQTAIEGNSLGQMPII
IAGNDQQKKKYLGRMTEEPLMCAYCVTEPGAGSDVAGIKTKAEKKGDEYI
INGQKMWITNGGKANWYFLLARSDPDPKAPANKAFTGFIVEADTPGIQIG
RKELNMGQRCSDTRGIVFEDVKVPKENVLIGDGAGFKVAMGAFDKERPVV
AAGAVGLAQRALDEATKYALERKTFGKLLVEHQAISFMLAEMAMKVELAR
MSYQRAAWEVDSGRRNTYYASIAKAFAGDIANQLATDAVQILGGNGFNTE
YPVEKLMRDAKIYQIYGGTSQIQRLIVAREHIDKYKN

3D structure

PDB

1egc Crystal structures of the wild type and the Glu376Gly/Thr255Glu mutant of human medium-chain acyl-CoA dehydrogenase: influence of the location of the catalytic base on substrate specificity.

Chain

Resolution

2.6 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	V135 T136 E255 G376 R388
Catalytic site (residue number reindexed from 1)	V126 T127 E246 G367 R379
Enzyme Commision number	1.3.8.7: medium-chain acyl-CoA dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CO8	C	E99 G100 S142 V144 N191 F245 M249 F252 D253 T326 Y375 G376 R388	E90 G91 S133 V135 N182 F236 M240 F243 D244 T317 Y366 G367 R379
BS02	FAD	C	Y133 T136 G141 S142 W166 I167 T168 I374 Y375 T378 Q380	Y124 T127 G132 S133 W157 I158 T159 I365 Y366 T369 Q371
BS03	FAD	C	R281 T283 F284 L288 I294 Q349 I350 G353	R272 T274 F275 L279 I285 Q340 I341 G344

Gene Ontology

	Molecular Function
GO:0003995	acyl-CoA dehydrogenase activity
GO:0016491	oxidoreductase activity
GO:0016627	oxidoreductase activity, acting on the CH-CH group of donors
GO:0042802	identical protein binding
GO:0050660	flavin adenine dinucleotide binding
GO:0070991	medium-chain fatty acyl-CoA dehydrogenase activity

	Biological Process
GO:0001889	liver development
GO:0005978	glycogen biosynthetic process
GO:0006082	organic acid metabolic process
GO:0006111	regulation of gluconeogenesis
GO:0006631	fatty acid metabolic process
GO:0006635	fatty acid beta-oxidation
GO:0007507	heart development
GO:0009409	response to cold
GO:0009437	carnitine metabolic process
GO:0009791	post-embryonic development
GO:0019254	carnitine metabolic process, CoA-linked
GO:0033539	fatty acid beta-oxidation using acyl-CoA dehydrogenase
GO:0042594	response to starvation
GO:0045329	carnitine biosynthetic process
GO:0051791	medium-chain fatty acid metabolic process
GO:0051793	medium-chain fatty acid catabolic process
GO:0055007	cardiac muscle cell differentiation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005759	mitochondrial matrix
GO:0030424	axon
GO:0031966	mitochondrial membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1egc, PDBe:1egc, PDBj:1egc
PDBsum	1egc
PubMed	8823176
UniProt	P11310\|ACADM_HUMAN Medium-chain specific acyl-CoA dehydrogenase, mitochondrial (Gene Name=ACADM)

[Back to BioLiP]