Structure of PDB 1e3o Chain C

Receptor sequence
>1e3oC (length=132) Species: 9606 (Homo sapiens) [Search protein sequence]
EEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRF
EALNLSFKNMSKLKPLLEKWLNDAEKRTSIETNIRVALEKSFMENQKPTS
EDITLIAEQLNMEKEVIRVWFSNRRQKEKRIN
3D structure
PDB1e3o Differential Dimer Activities of the Transcription Factor Oct-1 by DNA-Induced Interface Swapping
ChainC
Resolution1.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C Q44 T45 S48 R105 T106 I108 R113 N151 Q44 T45 S48 R77 T78 I80 R85 N123
BS02 dna C S43 T45 T46 R49 K58 N59 K62 L63 R105 S128 R146 R153 Q154 K157 S43 T45 T46 R49 K58 N59 K62 L63 R77 S100 R118 R125 Q126 K129
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1e3o, PDBe:1e3o, PDBj:1e3o
PDBsum1e3o
PubMed11583619
UniProtP14859|PO2F1_HUMAN POU domain, class 2, transcription factor 1 (Gene Name=POU2F1)

[Back to BioLiP]