Structure of PDB 1dux Chain C

Receptor sequence
>1duxC (length=86) Species: 9606 (Homo sapiens) [Search protein sequence]
VTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTN
MNYDKLSRALRYYYDKNIIRKVSGQKFVYKFVSYPE
3D structure
PDB1dux Structure of the elk-1-DNA complex reveals how DNA-distal residues affect ETS domain recognition of DNA.
ChainC
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C Y57 R62 R65 Y68 K75 K80 F81 Y53 R58 R61 Y64 K71 K76 F77
BS02 dna C T6 W46 K50 K52 D58 K59 Y66 Y67 T2 W42 K46 K48 D54 K55 Y62 Y63
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1dux, PDBe:1dux, PDBj:1dux
PDBsum1dux
PubMed10742173
UniProtP19419|ELK1_HUMAN ETS domain-containing protein Elk-1 (Gene Name=ELK1)

[Back to BioLiP]