Structure of PDB 1ddn Chain C

Receptor sequence

>1ddnC (length=118) Species: 1717 (Corynebacterium diphtheriae)

DLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDG
LVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEAD
RWEHVMSDEVERRLVKVL

3D structure

• PDB: 1ddn Structure of the metal-ion-activated diphtheria toxin repressor/tox operator complex.
• Chain: C
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	C	T7 Q36 S37 P39 T40 Q43 R47 R50	T5 Q34 S35 P37 T38 Q41 R45 R48
BS02	dna	C	R27 A28 R29 S42 R60	R25 A26 R27 S40 R58

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0017124 SH3 domain binding
• GO:0042802 identical protein binding
• GO:0046914 transition metal ion binding
• GO:0046983 protein dimerization activity

Biological Process

• GO:0006355 regulation of DNA-templated transcription
• GO:0045892 negative regulation of DNA-templated transcription

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:1ddn, PDBe:1ddn, PDBj:1ddn
• PDBsum: 1ddn
• PubMed: 9697776
• UniProt: P0DJL7|DTXR_CORDI Diphtheria toxin repressor (Gene Name=dtxR)