Structure of PDB 1btg Chain C |
>1btgC (length=109) Species: 10090 (Mus musculus) [Search protein sequence] |
GEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCR ASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACV CVLSRKATR |
|
PDB | 1btg Nerve growth factor in different crystal forms displays structural flexibility and reveals zinc binding sites. |
Chain | C |
Resolution | 2.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
C |
H84 D105 |
H75 D96 |
|
|
|
|