Structure of PDB 1bjj Chain C

Receptor sequence
>1bjjC (length=122) Species: 8714 (Gloydius halys) [Search protein sequence]
NLLQFNKMIKEETGKNAIPFYAFYGCYCGWGGQGKPKDGTDRCCFVHDCC
YGRLVNCNTKSDIYSYSLKEGYITCGKGTNCEEQICECDRVAAECFRRNL
DTYNNGYMFYRDSKCTETSEEC
3D structure
PDB1bjj Structure of agkistrodotoxin in an orthorhombic crystal form with six molecules per asymmetric unit.
ChainC
Resolution2.8 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) Y28 G30 G32 H48 D49 Y52 Y73 D99
Catalytic site (residue number reindexed from 1) Y27 G29 G31 H47 D48 Y51 Y64 D89
Enzyme Commision number 3.1.1.4: phospholipase A2.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA C D71 I72 E92 D62 I63 E82
Gene Ontology
Molecular Function
GO:0004623 phospholipase A2 activity
GO:0005509 calcium ion binding
GO:0005543 phospholipid binding
GO:0016787 hydrolase activity
GO:0046872 metal ion binding
GO:0047498 calcium-dependent phospholipase A2 activity
GO:0090729 toxin activity
Biological Process
GO:0006644 phospholipid metabolic process
GO:0016042 lipid catabolic process
GO:0035821 modulation of process of another organism
GO:0042130 negative regulation of T cell proliferation
GO:0050482 arachidonate secretion
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1bjj, PDBe:1bjj, PDBj:1bjj
PDBsum1bjj
PubMed10666574
UniProtP14421|PA2N_GLOHA Neutral phospholipase A2 agkistrodotoxin

[Back to BioLiP]