Structure of PDB 1bi9 Chain C

Receptor sequence
>1bi9C (length=480) Species: 10116 (Rattus norvegicus) [Search protein sequence]
MASLQLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVCNPATGEQVCEV
QEADKVDIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAT
LATMESLNGGKPFLQAFYIDLQGVIKTLRYYAGWADKIHGMTIPVDGDYF
TFTRHEPIGVCGQIIPWNFPLLMFTWKIAPALCCGNTVVIKPAEQTPLSA
LYMGALIKEAGFPPGVVNILPGYGPTAGAAIASHIGIDKIAFTGSTEVGK
LIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQC
CTAGSRIFVEESIYEEFVKRSVERAKRRIVGSPFDPTTEQGPQIDKKQYN
KILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIF
GPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALMVSSAMQAGTV
WINCYNAGEFGLREYSEVKTVTVKIPQKNS
3D structure
PDB1bi9 The structure of retinal dehydrogenase type II at 2.7 A resolution: implications for retinal specificity.
ChainC
Resolution2.7 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) N169 K192 E268 C302 E399
Catalytic site (residue number reindexed from 1) N168 K191 E267 C301 E398
Enzyme Commision number 1.2.1.36: retinal dehydrogenase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 NAD C I165 K192 A194 E195 G225 G229 A230 S246 V249 I164 K191 A193 E194 G224 G228 A229 S245 V248
Gene Ontology
Molecular Function
GO:0001758 retinal dehydrogenase activity
GO:0004028 3-chloroallyl aldehyde dehydrogenase activity
GO:0004029 aldehyde dehydrogenase (NAD+) activity
GO:0016491 oxidoreductase activity
GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0016918 retinal binding
Biological Process
GO:0001568 blood vessel development
GO:0001822 kidney development
GO:0001889 liver development
GO:0002138 retinoic acid biosynthetic process
GO:0003007 heart morphogenesis
GO:0006629 lipid metabolic process
GO:0007494 midgut development
GO:0008283 cell population proliferation
GO:0008284 positive regulation of cell population proliferation
GO:0008285 negative regulation of cell population proliferation
GO:0009855 determination of bilateral symmetry
GO:0009952 anterior/posterior pattern specification
GO:0009954 proximal/distal pattern formation
GO:0010628 positive regulation of gene expression
GO:0014032 neural crest cell development
GO:0016331 morphogenesis of embryonic epithelium
GO:0021915 neural tube development
GO:0021983 pituitary gland development
GO:0030182 neuron differentiation
GO:0030324 lung development
GO:0030326 embryonic limb morphogenesis
GO:0030900 forebrain development
GO:0030902 hindbrain development
GO:0031016 pancreas development
GO:0031076 embryonic camera-type eye development
GO:0032355 response to estradiol
GO:0032526 response to retinoic acid
GO:0033189 response to vitamin A
GO:0034097 response to cytokine
GO:0035115 embryonic forelimb morphogenesis
GO:0035799 ureter maturation
GO:0042572 retinol metabolic process
GO:0042573 retinoic acid metabolic process
GO:0042574 retinal metabolic process
GO:0042904 9-cis-retinoic acid biosynthetic process
GO:0043010 camera-type eye development
GO:0043065 positive regulation of apoptotic process
GO:0048384 retinoic acid receptor signaling pathway
GO:0048566 embryonic digestive tract development
GO:0048738 cardiac muscle tissue development
GO:0051289 protein homotetramerization
GO:0060324 face development
GO:0071300 cellular response to retinoic acid
GO:1905562 regulation of vascular endothelial cell proliferation
Cellular Component
GO:0005737 cytoplasm
GO:0048471 perinuclear region of cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1bi9, PDBe:1bi9, PDBj:1bi9
PDBsum1bi9
PubMed10320326
UniProtQ63639|AL1A2_RAT Retinal dehydrogenase 2 (Gene Name=Aldh1a2)

[Back to BioLiP]