Structure of PDB 1bdt Chain C

Receptor sequence
>1bdtC (length=50) Species: 10754 (Lederbergvirus P22) [Search protein sequence]
MKGMSKMPQFNLRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGR
3D structure
PDB1bdt Origins of DNA-binding specificity: role of protein contacts with the DNA backbone.
ChainC
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C Q9 F10 N11 R13 Q9 F10 N11 R13 PDBbind-CN: Kd=12pM
BS02 dna C M1 K2 G3 M4 S5 R23 S32 V33 N34 M1 K2 G3 M4 S5 R23 S32 V33 N34 PDBbind-CN: Kd=12pM
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1bdt, PDBe:1bdt, PDBj:1bdt
PDBsum1bdt
PubMed9927650
UniProtP03050|RARC_BPP22 Transcriptional repressor arc (Gene Name=arc)

[Back to BioLiP]