Structure of PDB 1bc7 Chain C

Receptor sequence
>1bc7C (length=93) Species: 9606 (Homo sapiens) [Search protein sequence]
MDSAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKN
KPNMNYDKLSRALRYYYVKNIIKKVNGQKFVYKFVSYPEILNM
3D structure
PDB1bc7 Structures of SAP-1 bound to DNA targets from the E74 and c-fos promoters: insights into DNA sequence discrimination by Ets proteins.
ChainC
Resolution2.01 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C Y56 R61 R64 Y67 K74 K79 F80 Y56 R61 R64 Y67 K74 K79 F80
BS02 dna C T6 W45 K49 K51 M54 K58 R61 Y65 Y66 T6 W45 K49 K51 M54 K58 R61 Y65 Y66
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1bc7, PDBe:1bc7, PDBj:1bc7
PDBsum1bc7
PubMed9734357
UniProtP28324|ELK4_HUMAN ETS domain-containing protein Elk-4 (Gene Name=ELK4)

[Back to BioLiP]