Structure of PDB 1b2z Chain C |
>1b2zC (length=107) Species: 1390 (Bacillus amyloliquefaciens) [Search protein sequence] |
INTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGG DIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSNWLIYKTTDHY QTFTKIR |
|
PDB | 1b2z A structural double-mutant cycle: estimating the strength of a buried salt bridge in barnase. |
Chain | C |
Resolution | 2.03 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
C |
E60 K62 |
E57 K59 |
|
|
|
|