Structure of PDB 1a2p Chain C |
>1a2pC (length=108) Species: 1390 (Bacillus amyloliquefaciens) [Search protein sequence] |
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIG GDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDH YQTFTKIR |
|
PDB | 1a2p Refinement and structural analysis of barnase at 1.5 A resolution. |
Chain | C |
Resolution | 1.5 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
C |
E60 K62 |
E58 K60 |
|
|
|
|