Structure of PDB 8oir Chain Bz

Receptor sequence

>8oirBz (length=97) Species: 9606 (Homo sapiens)

IGIRLTLPPPKVVDRWNEKRAMFGVYDNIGILGNFEKHPKELIRGPIWLR
GWKGNELQRCIRKRKMVGSRMFADDLHNLNKRIRYLYKHFNRHGKFR

3D structure

• PDB: 8oir Molecular basis of translation termination at noncanonical stop codons in human mitochondria.
• Chain: Bz
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Bz	I32 I34 R35 L36 K42 R46 K50 R51 F66 H69 P70 E72 R75 G76 P77 W79 R93 K94 R95 K96 G99 K112 R113 R115 Y116 Y118 H120 F121 R123 H124 K126 F127	I1 I3 R4 L5 K11 R15 K19 R20 F35 H38 P39 E41 R44 G45 P46 W48 R62 K63 R64 K65 G68 K81 R82 R84 Y85 Y87 H89 F90 R92 H93 K95 F96

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005761 mitochondrial ribosome
• GO:0005762 mitochondrial large ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8oir, PDBe:8oir, PDBj:8oir
• PDBsum: 8oir
• PubMed: 37141370
• UniProt: Q4U2R6|RM51_HUMAN Large ribosomal subunit protein mL51 (Gene Name=MRPL51)