Structure of PDB 7o80 Chain By

Receptor sequence

>7o80By (length=416) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

SAADRNVEIWKIKKLIKSLEAARGNGTSMISLIIPPKDQISRVAKMLADE
FGTASNIKSRVNRLSVLGAITSVQQRLKLYNKVPPNGLVVYCGTIVTEEG
KEKKVNIDFEPFKPINTSLYLCDNKFHTEALTALLSDDSKFGFIVIDGSG
ALFGTLQGNTREVLHKFTVDLPKKHGRAAQSALRFARLRMEKRHNYVRKV
AETAVQLFISGDKVNVAGLVLAGSADFKTELSQSDMFDQRLQSKVLKLVD
ISYGGENGFNQAIELSTEVLSNVKFIQEKKLIGRYFDEISQDTGKYCFGV
EDTLKALEMGAVEILIVYENLDIMRYVLHCQGTEEEKILYLTPEQEKDKS
HFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKG
FGGIGGILRYRVDFQG

3D structure

PDB

7o80 Structural basis of ribosomal frameshifting during translation of the SARS-CoV-2 RNA genome.

Chain

Resolution

2.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	By	R65 L69 Q80 L126 C127	R60 L64 Q75 L121 C122
BS02	rna	By	T58 N61 S64 C127	T53 N56 S59 C122
BS03	rna	By	K50 H180 G181	K45 H175 G176
BS04	rna	By	K42 Q44 N121 T122 S123 G153 R166 K178 R182 A184 Q185 R189 R192 L193 M195 E196 S229 D231 I256 S257 Q296 K384 F385 G386 R414 Y415	K37 Q39 N116 T117 S118 G148 R161 K173 R177 A179 Q180 R184 R187 L188 M190 E191 S224 D226 I251 S252 Q291 K379 F380 G381 R409 Y410

Gene Ontology

	Molecular Function
GO:0003747	translation release factor activity
GO:0004045	aminoacyl-tRNA hydrolase activity
GO:0008079	translation termination factor activity
GO:0016149	translation release factor activity, codon specific
GO:1990825	sequence-specific mRNA binding

	Biological Process
GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
GO:0002184	cytoplasmic translational termination
GO:0006412	translation
GO:0006415	translational termination
GO:0006449	regulation of translational termination
GO:0006479	protein methylation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0018444	translation release factor complex
GO:0022626	cytosolic ribosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7o80, PDBe:7o80, PDBj:7o80
PDBsum	7o80
PubMed	34029205
UniProt	P62497\|ERF1_RABIT Eukaryotic peptide chain release factor subunit 1 (Gene Name=ETF1)

[Back to BioLiP]