Structure of PDB 7o80 Chain By
Receptor sequence
| >7o80By (length=416) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] |
| SAADRNVEIWKIKKLIKSLEAARGNGTSMISLIIPPKDQISRVAKMLADE FGTASNIKSRVNRLSVLGAITSVQQRLKLYNKVPPNGLVVYCGTIVTEEG KEKKVNIDFEPFKPINTSLYLCDNKFHTEALTALLSDDSKFGFIVIDGSG ALFGTLQGNTREVLHKFTVDLPKKHGRAAQSALRFARLRMEKRHNYVRKV AETAVQLFISGDKVNVAGLVLAGSADFKTELSQSDMFDQRLQSKVLKLVD ISYGGENGFNQAIELSTEVLSNVKFIQEKKLIGRYFDEISQDTGKYCFGV EDTLKALEMGAVEILIVYENLDIMRYVLHCQGTEEEKILYLTPEQEKDKS HFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKG FGGIGGILRYRVDFQG |
3D structure
| PDB | 7o80 Structural basis of ribosomal frameshifting during translation of the SARS-CoV-2 RNA genome. | ||
| Chain | By | ||
| Resolution | 2.9 Å | ||
| 3D structure |
|
Enzymatic activity
| Enzyme Commision number | ? |
Interaction with ligand
| Site # |
Ligand | Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
|---|---|---|---|---|---|
| BS01 | rna | By | R65 L69 Q80 L126 C127 | R60 L64 Q75 L121 C122 | |
| BS02 | rna | By | T58 N61 S64 C127 | T53 N56 S59 C122 | |
| BS03 | rna | By | K50 H180 G181 | K45 H175 G176 | |
| BS04 | rna | By | K42 Q44 N121 T122 S123 G153 R166 K178 R182 A184 Q185 R189 R192 L193 M195 E196 S229 D231 I256 S257 Q296 K384 F385 G386 R414 Y415 | K37 Q39 N116 T117 S118 G148 R161 K173 R177 A179 Q180 R184 R187 L188 M190 E191 S224 D226 I251 S252 Q291 K379 F380 G381 R409 Y410 |
Gene Ontology
| Molecular Function | |
|---|---|
| GO:0003747 | translation release factor activity |
| GO:0004045 | aminoacyl-tRNA hydrolase activity |
| GO:0008079 | translation termination factor activity |
| GO:0016149 | translation release factor activity, codon specific |
| GO:1990825 | sequence-specific mRNA binding |
