Structure of PDB 4v7k Chain By

Receptor sequence

>4v7kBy (length=94) Species: 83333 (Escherichia coli K-12)

AYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCY
KIKLRSSGYRLVYQVIDEKVVVFVISVGKRERSEVYSEAVKRIL

3D structure

• PDB: 4v7k The structural basis for mRNA recognition and cleavage by the ribosome-dependent endonuclease RelE.
• Chain: By
• Resolution: 3.6 Å

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	By	K13 K17 S20 T21 Q25 K28 K29 E32 A41 K43 L44 R45 L55 R56 S57 Y60 K80 R81 E82 R83	K12 K16 S19 T20 Q24 K27 K28 E31 A40 K42 L43 R44 L54 R55 S56 Y59 K79 R80 E81 R82
BS02	rna	By	L44 R45 K52 K54 Y87	L43 R44 K51 K53 Y86
BS03	rna	By	K54 R61 Y87	K53 R60 Y86

Gene Ontology

Molecular Function

• GO:0000976 transcription cis-regulatory region binding
• GO:0001217 DNA-binding transcription repressor activity
• GO:0004519 endonuclease activity
• GO:0004521 RNA endonuclease activity
• GO:0005515 protein binding
• GO:0019843 rRNA binding
• GO:0043022 ribosome binding
• GO:0097351 toxin sequestering activity

Biological Process

• GO:0006355 regulation of DNA-templated transcription
• GO:0006402 mRNA catabolic process
• GO:0017148 negative regulation of translation
• GO:0034198 cellular response to amino acid starvation
• GO:0040008 regulation of growth
• GO:0044010 single-species biofilm formation
• GO:0045892 negative regulation of DNA-templated transcription
• GO:0046677 response to antibiotic

Cellular Component

• GO:0032993 protein-DNA complex
• GO:0110001 toxin-antitoxin complex

External links

• PDB: RCSB:4v7k, PDBe:4v7k, PDBj:4v7k
• PDBsum: 4v7k
• PubMed: 20005802
• UniProt: P0C077|RELE_ECOLI mRNA interferase toxin RelE (Gene Name=relE)