Structure of PDB 4v7j Chain By

Receptor sequence

>4v7jBy (length=94) Species: 83333 (Escherichia coli K-12)

AYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLAGMPDCY
KIKLRSSGYRLVYQVIDEKVVVFVISVGKAERSEVYSEAVKRIL

3D structure

• PDB: 4v7j The structural basis for mRNA recognition and cleavage by the ribosome-dependent endonuclease RelE.
• Chain: By
• Resolution: 3.3 Å

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	By	R10 K17 T21 Q25 K28 K29 E32 A41 K43 L44 K54 L55 R56 S57 Y60 K80	R9 K16 T20 Q24 K27 K28 E31 A40 K42 L43 K53 L54 R55 S56 Y59 K79
BS02	rna	By	R56 E82 S84 Y87	R55 E81 S83 Y86

Gene Ontology

Molecular Function

• GO:0000976 transcription cis-regulatory region binding
• GO:0001217 DNA-binding transcription repressor activity
• GO:0004519 endonuclease activity
• GO:0004521 RNA endonuclease activity
• GO:0005515 protein binding
• GO:0019843 rRNA binding
• GO:0043022 ribosome binding
• GO:0097351 toxin sequestering activity

Biological Process

• GO:0006355 regulation of DNA-templated transcription
• GO:0006402 mRNA catabolic process
• GO:0017148 negative regulation of translation
• GO:0034198 cellular response to amino acid starvation
• GO:0040008 regulation of growth
• GO:0044010 single-species biofilm formation
• GO:0045892 negative regulation of DNA-templated transcription
• GO:0046677 response to antibiotic

Cellular Component

• GO:0032993 protein-DNA complex
• GO:0110001 toxin-antitoxin complex

External links

• PDB: RCSB:4v7j, PDBe:4v7j, PDBj:4v7j
• PDBsum: 4v7j
• PubMed: 20005802
• UniProt: P0C077|RELE_ECOLI mRNA interferase toxin RelE (Gene Name=relE)