Structure of PDB 7nsi Chain Bx

Receptor sequence

>7nsiBx (length=162) Species: 9823 (Sus scrofa) [Search protein sequence]

FREVVEILDGKTTIIEGRITETPQESPNPPNPTGQCPICRWNLKHKYNYE
DVLLLSQFIRPHGGMLPRRITGLCQEEHLKIEECVKMAHRAGLLPNHRPK
LPEGFVPKSKPRLNRYLTRWSPRSVKPIYNKGHRWNKVRMPVGSPLLKDN
VSYSGRPLLLYH

3D structure

PDB

7nsi Structural basis of translation termination, rescue, and recycling in mammalian mitochondria.

Chain

Resolution

4.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Bx	R36 N82 R94 G97 M99 P101 R102 K120 R124 P133 G138 R146 Y150 L151 R153 W154 S155 R157 S158 K160 Y163 N164 K165 G166 H167 R168 R173 K182 V185 R190 L192 L193 Y195 H196	R2 N48 R60 G63 M65 P67 R68 K86 R90 P99 G104 R112 Y116 L117 R119 W120 S121 R123 S124 K126 Y129 N130 K131 G132 H133 R134 R139 K148 V151 R156 L158 L159 Y161 H162
BS02	ZN	Bx	C70 C108	C36 C74

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005739	mitochondrion
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7nsi, PDBe:7nsi, PDBj:7nsi
PDBsum	7nsi
PubMed	33878294
UniProt	A0A5G2R1G5

[Back to BioLiP]