Structure of PDB 6gb2 Chain Bx

Receptor sequence

>6gb2Bx (length=162) Species: 9823 (Sus scrofa)

FREVVEILDGKTTIIEGRITETPQESPNPPNPTGQCPICRWNLKHKYNYE
DVLLLSQFIRPHGGMLPRRITGLCQEEHLKIEECVKMAHRAGLLPNHRPK
LPEGFVPKSKPRLNRYLTRWSPRSVKPIYNKGHRWNKVRMPVGSPLLKDN
VSYSGRPLLLYH

3D structure

• PDB: 6gb2 Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM.
• Chain: Bx
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Bx	N82 R94 H96 G98 M99 P101 R102 H112 E116 K120 H123 R124 R132 P133 G138 P141 R146 Y150 L151 R153 W154 S155 R157 S158 K160 Y163 N164 K165 G166 H167 R168 W169 K171 R173 S188 R190 L192 L193 Y195 H196	N48 R60 H62 G64 M65 P67 R68 H78 E82 K86 H89 R90 R98 P99 G104 P107 R112 Y116 L117 R119 W120 S121 R123 S124 K126 Y129 N130 K131 G132 H133 R134 W135 K137 R139 S154 R156 L158 L159 Y161 H162
BS02	ZN	Bx	C70 C108	C36 C74

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome

External links

• PDB: RCSB:6gb2, PDBe:6gb2, PDBj:6gb2
• PDBsum: 6gb2
• PubMed: 30089917
• UniProt: F1RRH6