Structure of PDB 5aj4 Chain Bx

Receptor sequence

>5aj4Bx (length=162) Species: 9823 (Sus scrofa) [Search protein sequence]

FREVVEILDGKTTIIEGRITETPQESPNPPNPTGQCPICRWNLKHKYNYE
DVLLLSQFIRPHGGMLPRRITGLCQEEHLKIEECVKMAHRAGLLPNHRPK
LPEGFVPKSKPRLNRYLTRWSPRSVKPIYNKGHRWNKVRMPVGSPLLKDN
VSYSGRPLLLYH

3D structure

PDB

5aj4 The complete structure of the 55S mammalian mitochondrial ribosome.

Chain

Resolution

3.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Bx	N82 R94 G98 M99 L100 P101 R102 R103 H112 E116 H123 R124 R132 P133 G138 P141 R146 L151 W154 S155 R157 S158 K160 Y163 N164 K165 G166 H167 R168 R173 S188 R190 L192 L193 Y195 H196	N48 R60 G64 M65 L66 P67 R68 R69 H78 E82 H89 R90 R98 P99 G104 P107 R112 L117 W120 S121 R123 S124 K126 Y129 N130 K131 G132 H133 R134 R139 S154 R156 L158 L159 Y161 H162
BS02	ZN	Bx	C70 C108	C36 C74

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5aj4, PDBe:5aj4, PDBj:5aj4
PDBsum	5aj4
PubMed	25837512
UniProt	F1RRH6

[Back to BioLiP]