Structure of PDB 8ove Chain Bw

Receptor sequence

>8oveBw (length=230) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence]

IKRAAFKQQQTENFKKAIAANKVAAAALKKLAYSRGLKYSREYRSTEKKL
AGLRRNARQHGNYYLEAKPKVAVVTRIRGIAKVPPKQRKILQLLRLRQIF
NTVFVRLNKPMENMLRAVEPYIAYGYPSLSTVRAMVYKRGHLKINGQRVK
ITDNQMIKDKYHNDDIVCAEDIVNQIYACGKHFRTVTNGLWPFKLAPPAG
GMRQKRRHFVEGGDYGNRDTLINRFLARMI

3D structure

PDB

8ove A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.

Chain

Resolution

2.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Bw	K29 R30 F33 I45 K49 R68 R71 K75 G79 R82 N83 R85 Q86 H87 R105 G106 K109 P112 K116 I117 L120 I126 P137 N140 M141 S155 S157 R166 Q174 R175 R211 N215 K221 P224 P225 A226 G227 G228 M229 K232 N250 R251	K2 R3 F6 I18 K22 R41 R44 K48 G52 R55 N56 R58 Q59 H60 R78 G79 K82 P85 K89 I90 L93 I99 P110 N113 M114 S128 S130 R139 Q147 R148 R184 N188 K194 P197 P198 A199 G200 G201 M202 K205 N223 R224
BS02	rna	Bw	R233 R234 H235	R206 R207 H208

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ove, PDBe:8ove, PDBj:8ove
PDBsum	8ove
PubMed	37985661
UniProt	Q57V35

[Back to BioLiP]