Structure of PDB 8ova Chain Bw

Receptor sequence

>8ovaBw (length=230) Species: 5702 (Trypanosoma brucei brucei)

IKRAAFKQQQTENFKKAIAANKVAAAALKKLAYSRGLKYSREYRSTEKKL
AGLRRNARQHGNYYLEAKPKVAVVTRIRGIAKVPPKQRKILQLLRLRQIF
NTVFVRLNKPMENMLRAVEPYIAYGYPSLSTVRAMVYKRGHLKINGQRVK
ITDNQMIKDKYHNDDIVCAEDIVNQIYACGKHFRTVTNGLWPFKLAPPAG
GMRQKRRHFVEGGDYGNRDTLINRFLARMI

3D structure

• PDB: 8ova A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
• Chain: Bw
• Resolution: 2.47 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Bw	K29 R30 F33 I45 K49 R68 R71 K75 G79 N83 R85 Q86 H87 R105 G106 K109 P112 K113 K116 I117 L120 R133 N135 K136 P137 E139 N140 S155 S157 R166 Q174 R175 K221 L222 P224 P225 A226 G227 G228 M229 K232 T247 N250 R251	K2 R3 F6 I18 K22 R41 R44 K48 G52 N56 R58 Q59 H60 R78 G79 K82 P85 K86 K89 I90 L93 R106 N108 K109 P110 E112 N113 S128 S130 R139 Q147 R148 K194 L195 P197 P198 A199 G200 G201 M202 K205 T220 N223 R224
BS02	rna	Bw	E146 R233 R234 H235 E238	E119 R206 R207 H208 E211

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit

External links

• PDB: RCSB:8ova, PDBe:8ova, PDBj:8ova
• PDBsum: 8ova
• PubMed: 37985661
• UniProt: Q57V35