Structure of PDB 4v8m Chain Bw

Receptor sequence

>4v8mBw (length=257)

MFMTGLILLGKGREVMPAKAVPAPESAIKRAAFKQQQTENFKKAIAANKV
AAAALKKLAYSRGLKYSREYRSTEKKLAGLRRNARQHGNYYLEAKPKVAV
VTRIRGIAKVPPKQRKILQLLRLRQIFNTVFVRLNKPMENMLRAVEPYIA
YGYPSLSTVRAMVYKRGHLKINGQRVKITDNQMIKDKYHNDDIVCAEDIV
NQIYACGKHFRTVTNGLWPFKLAPPAGGMRQKRRHFVEGGDYGNRDTLIN
RFLARMI

3D structure

• PDB: 4v8m High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
• Chain: Bw
• Resolution: 5.57 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Bw	M1 F2 A20 V21 P22 A23 P24 E25 S26 A27 I28 K29 R30 F33 K34 Q36 Q37 K49 R68 R71 R82 N83 R85 Q86 H87 N89 R105 G106 I107 A108 K109 P111 P112 R115 K116 I117 R122 R124 Q125 I126 R133 K136 P137 M138 N140 M141 S155 S157 R166 K170 Q174 R175 K208 R211 N215 K221 P224 A226 M229 R230 K232 R233 N250 R251	M1 F2 A20 V21 P22 A23 P24 E25 S26 A27 I28 K29 R30 F33 K34 Q36 Q37 K49 R68 R71 R82 N83 R85 Q86 H87 N89 R105 G106 I107 A108 K109 P111 P112 R115 K116 I117 R122 R124 Q125 I126 R133 K136 P137 M138 N140 M141 S155 S157 R166 K170 Q174 R175 K208 R211 N215 K221 P224 A226 M229 R230 K232 R233 N250 R251
BS02	rna	Bw	R143 K232 R233 R234 H235 E238	R143 K232 R233 R234 H235 E238

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit

External links

• PDB: RCSB:4v8m, PDBe:4v8m, PDBj:4v8m
• PDBsum: 4v8m
• PubMed: 23395961
• UniProt: Q57V35