Structure of PDB 8ova Chain Bv

Receptor sequence

>8ovaBv (length=143) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence]

KVSRKSPEYSTVRKSCKPGTIAIILAGRFRGRRAVILKQLPKNGPLVISG
PMKYSGVPIRRIDSRYIIATSTRVDLTGVDTSAITPEIFKRETVSDERAQ
LQNAIDTALIQAIKKDPLGKEMAGYLHSVFTIKPGDAPHRLKW

3D structure

PDB

8ova A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.

Chain

Resolution

2.47 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Bv	T25 K28	T11 K14
BS02	rna	Bv	A40 R42 R44 P59 M66 K67 G70 P72 R74 R75 Y80 E106 T142 K169 H176 S177 V178 K182 P183	A26 R28 R30 P45 M52 K53 G56 P58 R60 R61 Y66 E92 T93 K120 H127 S128 V129 K133 P134

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0042301	phosphate ion binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0000315	organellar large ribosomal subunit
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links