Structure of PDB 8ove Chain Bu

Receptor sequence

>8oveBu (length=240) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence]

VKVVKNKAYYKRFQVKYRRRREGKTDYHARRRMVLQDKTKFGTPKYRLVV
RITNRDVIAQIVHAKVVGDEVVMAAYSHELPLFGIEHGLTNYAAAYATGL
LVARRMLAKLGLAEKFVGVKEVDGSYAAVRTKDDDQGDDESRFPFKAILD
VGLARTTTGARVFGVLKGAVDGGLAVPHRPNRFPGYNKESDALNAKVHRD
RIFGRHVADYLKQVREEASSDMEGMYKRAHAAIRADPTKR

3D structure

PDB

8ove A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.

Chain

Resolution

2.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	Bu	K5 V6 K10 R15 K43 T46 L113 K135 R145 F146 P147 F148	K2 V3 K7 R12 K40 T43 L110 K132 R142 F143 P144 F145
BS02	rna	Bu	V4 K8 Y12 F16 Q17 K19 R23 T28 R35 M36 K48 H181 R182 R185	V1 K5 Y9 F13 Q14 K16 R20 T25 R32 M33 K45 H178 R179 R182
BS03	rna	Bu	K10 Y13 K14 V18 Y20 R21 R22 R24 Y30 R33 R54 N57 R58 V69 D72 V74 T93 N94 Y95 R158 R164 Y213	K7 Y10 K11 V15 Y17 R18 R19 R21 Y27 R30 R51 N54 R55 V66 D69 V71 T90 N91 Y92 R155 R161 Y210

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0008097	5S rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation
GO:0042255	ribosome assembly

	Cellular Component
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ove, PDBe:8ove, PDBj:8ove
PDBsum	8ove
PubMed	37985661
UniProt	Q38CY8

[Back to BioLiP]