Structure of PDB 4v8m Chain Bu

Receptor sequence

>4v8mBu (length=298) [Search protein sequence]

TFVKVVKNKAYYKRFQVKYRRRREGKTDYHARRRMVLQDKTKFGTPKYRL
VVRITNRDVIAQIVHAKVVGDEVVMAAYSHELPLFGIEHGLTNYAAAYAT
GLLVARRMLAKLGLAEKFVGVKEVDGSYAAVRTKDDDQGDDESRFPFKAI
LDVGLARTTTGARVFGVLKGAVDGGLAVPHRPNRFPGYNKESDALNAKVH
RDRIFGRHVADYLKQVREEASSNPDEKTCQFSKFIAAKVSPDDMEGMYKR
AHAAIRADPTKRRAKKERPAEAKPKKYNTVKLTGAEKKAAAKAKVAAV

3D structure

PDB

4v8m High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.

Chain

Resolution

5.57 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	Bu	K5 K10 A11 R15 F44 T46 K118 V132 R133 T134 E143 S144 R145 F146 P147 K149	K4 K9 A10 R14 F43 T45 K117 V131 R132 T133 E142 S143 R144 F145 P146 K148
BS02	rna	Bu	T2 F3 K8 Y12 R15 F16 Q17 K19 R23 T28 D29 R35 M36 K48 V154 R158 R182	T1 F2 K7 Y11 R14 F15 Q16 K18 R22 T27 D28 R34 M35 K47 V153 R157 R181
BS03	rna	Bu	N9 Y13 V18 Y20 R21 R22 R24 Y30 R33 R50 V52 R54 T56 N57 R58 Q63 K68 V70 G71 D72 E73 V74 Y79 T93 N94 Y95 L156 R158 T160 T161 G162 R164 R204 H209 Y213 Q216 Q231 F232 S233 K234 F235 A265 K266 E268 R269 P270 A271 E272 K274 P275 K276 Y278 N279 T280 V281 K282 L283 K288 K289	N8 Y12 V17 Y19 R20 R21 R23 Y29 R32 R49 V51 R53 T55 N56 R57 Q62 K67 V69 G70 D71 E72 V73 Y78 T92 N93 Y94 L155 R157 T159 T160 G161 R163 R203 H208 Y212 Q215 Q230 F231 S232 K233 F234 A264 K265 E267 R268 P269 A270 E271 K273 P274 K275 Y277 N278 T279 V280 K281 L282 K287 K288

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0008097	5S rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation
GO:0042255	ribosome assembly

	Cellular Component
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v8m, PDBe:4v8m, PDBj:4v8m
PDBsum	4v8m
PubMed	23395961
UniProt	Q38CY8

[Back to BioLiP]