Structure of PDB 4ujc Chain Bu

Receptor sequence

>4ujcBu (length=210) Species: 9986 (Oryctolagus cuniculus)

ADQEIENAVSRALEDAPERNFRETVDLAVNLRDLDLNDPSNRVDESVVLP
AGTGQETTIVVFAEGETALRAEEVADDVLDEDELEELGGDDDAAKDLADD
TDFFIAEKGLMQDIGRYLGTVLGPRGKMPEPLDPDDDVVEVIERMKNTVQ
LRSGERRTFHTRVGAEDMSAENIADNIDVILRRLHADLEKGPLNIDTVYV
KTTMGPAMEV

3D structure

• PDB: 4ujc Structure of the Mammalian 80S Initiation Complex with Initiation Factor 5B on Hcv-Ires RNA.
• Chain: Bu
• Resolution: 9.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Bu	R19 N20 F21 A28 V29 N30 Q55 D92 K95 D99 P124 R152 E155 R156 T158 H160 T161 R162 L193 D196 Y199 K201 M204 A207	R19 N20 F21 A28 V29 N30 Q55 D92 K95 D99 P124 R152 E155 R156 T158 H160 T161 R162 L193 D196 Y199 K201 M204 A207

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Mar 7 16:20:11 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4ujc', asym_id = 'Bu', title = 'Structure of the Mammalian 80S Initiation Complex with Initiation Factor 5B on Hcv-Ires RNA.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4ujc', asym_id='Bu', title='Structure of the Mammalian 80S Initiation Complex with Initiation Factor 5B on Hcv-Ires RNA.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003723,0003735,0006412,0015934', uniprot = '', pdbid = '4ujc', asym_id = 'Bu'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0006412,0015934', uniprot='', pdbid='4ujc', asym_id='Bu')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>