Structure of PDB 8ove Chain Bt

Receptor sequence

>8oveBt (length=97) Species: 5702 (Trypanosoma brucei brucei)

VNYPKKKKMHCPDERCNAHKSFKVVQYKAGKARLYARGKRRYDRKQSGYG
GQTKPIFHKKAKTTKKIVLKLQCSNCKSIIQNVLKRTKHFELNDKKK

3D structure

• PDB: 8ove A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
• Chain: Bt
• Resolution: 2.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Bt	Y43 P56 I57	Y42 P55 I56
BS02	rna	Bt	R38 R41 R42 R45 K46 Y50 K55	R37 R40 R41 R44 K45 Y49 K54
BS03	rna	Bt	V2 N3 Y4 P5 K8 H11 R16 H20 Y28 G31 R34 A37 R38 G39 R41 G52 Q53 P56 F58 K60 A62 K63 T65 K67 V69 Q82 V84 K86 K89 H90 K97 K98	V1 N2 Y3 P4 K7 H10 R15 H19 Y27 G30 R33 A36 R37 G38 R40 G51 Q52 P55 F57 K59 A61 K62 T64 K66 V68 Q81 V83 K85 K88 H89 K96 K97

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8ove, PDBe:8ove, PDBj:8ove
• PDBsum: 8ove
• PubMed: 37985661
• UniProt: P17843|RL44_TRYBB Large ribosomal subunit protein eL42 (Gene Name=RPL44)