Structure of PDB 7nsj Chain Bt

Receptor sequence

>7nsjBt (length=94) Species: 9823 (Sus scrofa) [Search protein sequence]

RNRIPGRQWIGKHRRPRPVSAQAKQNMIRRLETEAENQYWLSRPFLTAEQ
ERGHAAVRRAAAFQALKAAQAARFPAHRRLEEQLGHLLVTRKWS

3D structure

PDB

7nsj Structural basis of translation termination, rescue, and recycling in mammalian mitochondria.

Chain

Resolution

3.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Bt	R9 N10 R11 I12 P13 G14 R15 Q16 W17 I18 G19 K20 H21 R22 R23 R25 P26 S28 N34 R60 G61 H62 A63 A64 R66 R67 F71 Q78 R81 H94 K100	R1 N2 R3 I4 P5 G6 R7 Q8 W9 I10 G11 K12 H13 R14 R15 R17 P18 S20 N26 R52 G53 H54 A55 A56 R58 R59 F63 Q70 R73 H86 K92
BS02	MG	Bt	P13 G14 R15 G19	P5 G6 R7 G11

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005739	mitochondrion
GO:0005761	mitochondrial ribosome
GO:0005762	mitochondrial large ribosomal subunit

External links