Structure of PDB 7nqh Chain Bt

Receptor sequence

>7nqhBt (length=94) Species: 9823 (Sus scrofa) [Search protein sequence]

RNRIPGRQWIGKHRRPRPVSAQAKQNMIRRLETEAENQYWLSRPFLTAEQ
ERGHAAVRRAAAFQALKAAQAARFPAHRRLEEQLGHLLVTRKWS

3D structure

PDB

7nqh Structural basis of translation termination, rescue, and recycling in mammalian mitochondria.

Chain

Resolution

3.5 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Bt	R9 R11 I12 P13 G14 R15 Q16 W17 I18 G19 K20 H21 R22 R23 R25 S28 N34 R60 G61 H62 A63 A64 R66 R67 F71 L74 K75 Q78 R81 R86 H94	R1 R3 I4 P5 G6 R7 Q8 W9 I10 G11 K12 H13 R14 R15 R17 S20 N26 R52 G53 H54 A55 A56 R58 R59 F63 L66 K67 Q70 R73 R78 H86
BS02	MG	Bt	P13 G14 R15 G19	P5 G6 R7 G11

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005739	mitochondrion
GO:0005761	mitochondrial ribosome
GO:0005762	mitochondrial large ribosomal subunit

External links