Structure of PDB 5aj4 Chain Bt

Receptor sequence
>5aj4Bt (length=94) Species: 9823 (Sus scrofa) [Search protein sequence]
RNRIPGRQWIGKHRRPRPVSAQAKQNMIRRLETEAENQYWLSRPFLTAEQ
ERGHAAVRRAAAFQALKAAQAARFPAHRRLEEQLGHLLVTRKWS
3D structure
PDB5aj4 The complete structure of the 55S mammalian mitochondrial ribosome.
ChainBt
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Bt R9 N10 I12 P13 G14 R15 Q16 W17 I18 G19 K20 H21 R23 R25 S28 Q30 N34 R37 G61 H62 A63 R66 R67 F71 K75 Q78 R81 H94 R1 N2 I4 P5 G6 R7 Q8 W9 I10 G11 K12 H13 R15 R17 S20 Q22 N26 R29 G53 H54 A55 R58 R59 F63 K67 Q70 R73 H86
BS02 MG Bt R15 G19 R7 G11
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sun Nov 17 00:51:28 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5aj4', asym_id = 'Bt', title = 'The complete structure of the 55S mammalian mitochondrial ribosome.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5aj4', asym_id='Bt', title='The complete structure of the 55S mammalian mitochondrial ribosome.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0005761', uniprot = '', pdbid = '5aj4', asym_id = 'Bt'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0005761', uniprot='', pdbid='5aj4', asym_id='Bt')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>