Structure of PDB 8ove Chain Bs

Receptor sequence
>8oveBs (length=50) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence]
MEPTLEALAKKYNWEKKVCRRCYARLPVRATNCRKKGCGHCSNLRMKKKL
3D structure
PDB8ove A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
ChainBs
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Bs R97 Y100 R102 R122 K124 K125 R20 Y23 R25 R45 K47 K48
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0031386 protein tag activity
GO:0031625 ubiquitin protein ligase binding
Biological Process
GO:0006412 translation
GO:0016567 protein ubiquitination
GO:0019941 modification-dependent protein catabolic process
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ove, PDBe:8ove, PDBj:8ove
PDBsum8ove
PubMed37985661
UniProtP21899|RL40_TRYBB Ubiquitin-ribosomal protein eL40 fusion protein

[Back to BioLiP]