Structure of PDB 8oit Chain Bs

Receptor sequence
>8oitBs (length=150) Species: 9606 (Homo sapiens) [Search protein sequence]
TARGTPSRFLASVLHNGLGRYVQQLQRLSFSVSRDGASSRGAREFVEREV
IDFARRNPGVVIYVNSRPCCVPRVVAEYLNGAVREESIHCKSVEEISTLV
QKLADQSGLDVIRIRKPFHTDNPSIQGQWHPFTNKPTTFRGLRPREVQDP
3D structure
PDB8oit Molecular basis of translation termination at noncanonical stop codons in human mitochondria.
ChainBs
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Bs X2 A3 R4 D36 A38 S39 P69 C71 V72 R74 H90 R114 R116 K117 X1 A2 R3 D35 A37 S38 P68 C70 V71 R73 H89 R113 R115 K116
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005761 mitochondrial ribosome
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8oit, PDBe:8oit, PDBj:8oit
PDBsum8oit
PubMed37141370
UniProtQ8N983|RM43_HUMAN Large ribosomal subunit protein mL43 (Gene Name=MRPL43)

[Back to BioLiP]