Structure of PDB 8ova Chain Br

Receptor sequence

>8ovaBr (length=367) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence]

RPSVSVYSASEDKVVGTCSLPAVFTAPIRHDVVQFVHTNMAKNSRQPYAV
NRLSGMKHSAESWGTGRAVARIPRIHGGGTSMSGAGAFGNMCRGGRMFAP
TKIFRRWHRKINLHQKRFAVVSALAASSLPALVMSRGHKIENVAEVPLVV
EDGVRAYEKTKEAMTFLKTVGAIDDVNRVNDSRQIRAGRGKMRNRRYVAR
RGPMLVMPDNKGTRAFRNIFGLDLANVNSLNLLHLAPGGHVGRFIIWTKS
AFEKLDKIFGTFTEPSTVKSGFMLPAPMLTSTDVTRIMQSEEVRRVLKPK
KLQPKRPSRYRQPTNGIRNRRLRLRLNPFQKKEKAMAKGMQNKKNREARH
AAKVVRLAKARKNVAKA

3D structure

PDB

8ova A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.

Chain

Resolution

2.47 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	Br	R32 Q37 F38 N46 R48 Q49 Y51 R55 L56 S57 M59 K60 H61 S62 V72 R74 P76 G81 G82 T83 A88 N93 M94 R96 G97 R99 M100 F101 K105 F107 R108 R109 N115 H117 Q118 R120 R139 E144 N145 K162 T163 R181 R189 A190 G191 R192 K194 R196 N197 R198 Y200 R203 R204 R217 R220 N221 D226 S232 N234 H237 G241 H243 S273 R297 K303 Q306 K308 R309 R312 Y313 R314 P316 N318 R321 N322 R323 R324 K334 K335 K337 M339 K341 Q344 N345 K347 N348 R349 R352 H353 A355 K356 K362 R364 K365 N366	R29 Q34 F35 N43 R45 Q46 Y48 R52 L53 S54 M56 K57 H58 S59 V69 R71 P73 G78 G79 T80 A85 N90 M91 R93 G94 R96 M97 F98 K102 F104 R105 R106 N112 H114 Q115 R117 R136 E141 N142 K159 T160 R178 R186 A187 G188 R189 K191 R193 N194 R195 Y197 R200 R201 R214 R217 N218 D223 S229 N231 H234 G238 H240 S270 R294 K300 Q303 K305 R306 R309 Y310 R311 P313 N315 R318 N319 R320 R321 K331 K332 K334 M336 K338 Q341 N342 K344 N345 R346 R349 H350 A352 K353 K359 R361 K362 N363
BS02	rna	Br	T68 G69 A71 R74	T65 G66 A68 R71
BS03	rna	Br	A52 K194 M195	A49 K191 M192

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ova, PDBe:8ova, PDBj:8ova
PDBsum	8ova
PubMed	37985661
UniProt	Q582N2

[Back to BioLiP]