Structure of PDB 8apo Chain Br

Receptor sequence

>8apoBr (length=90) Species: 353565 (Polytomella magna)

FRPRSTHQEVTEMADFKNVSFLTQFLSPAGRIQPRRVTKLTEPLQRRIAK
SVKLARNMALMAGEARLDKLHLTRVRQEELHRYQLKKSVQ

3D structure

• PDB: 8apo Structure of the mitochondrial ribosome from Polytomella magna with tRNAs bound to the A and P sites
• Chain: Br
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Br	R38 I39 Q52 K60 R63 N64 G70	R31 I32 Q45 K53 R56 N57 G63

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 00:56:26 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8apo', asym_id = 'Br', title = 'Structure of the mitochondrial ribosome from Polytomella magna with tRNAs bound to the A and P sites'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8apo', asym_id='Br', title='Structure of the mitochondrial ribosome from Polytomella magna with tRNAs bound to the A and P sites')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '8apo', asym_id = 'Br'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='8apo', asym_id='Br')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>