Structure of PDB 8q87 Chain Bp

Receptor sequence

>8q87Bp (length=91) Species: 9031 (Gallus gallus)

AKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRKA
VGIWHCGSCMKTVAGGAWTYNTTSAVTVKSAIRRLKELKDQ

3D structure

• PDB: 8q87 Structural insights into inactive ribosome complexes derived from cold-treated chick embryo cells
• Chain: Bp
• Resolution: 2.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Bp	A2 R4 T5 K6 K7 V8 G9 I10 G12 K13 Y14 G15 T16 R17 Y18 G19 A20 S21 L22 R23 Q33 H34 F41 C42 K44 K46 R49 A51 G58 S59 M61 K62 W69	A1 R3 T4 K5 K6 V7 G8 I9 G11 K12 Y13 G14 T15 R16 Y17 G18 A19 S20 L21 R22 Q32 H33 F40 C41 K43 K45 R48 A50 G57 S58 M60 K61 W68
BS02	ZN	Bp	C39 C42 C57 C60	C38 C41 C56 C59

External links

• PDB: RCSB:8q87, PDBe:8q87, PDBj:8q87
• PDBsum: 8q87
• UniProt: P32046|RL37A_CHICK Large ribosomal subunit protein eL43 (Gene Name=RPL37A)