Structure of PDB 8ove Chain Bp

Receptor sequence
>8oveBp (length=75) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence]
PREIKNLKEFLAICSRKDARCVKVKHNPKVTKFKVRCSRHLYTLVMADKK
KADKIERSIHPSVKKITVTSRSHAN
3D structure
PDB8ove A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
ChainBp
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Bp P2 R21 R37 R40 H41 L42 K65 I67 R72 H74 P1 R20 R36 R39 H40 L41 K64 I66 R71 H73
BS02 rna Bp R17 D19 S39 R16 D18 S38
BS03 rna Bp P2 R3 E4 K26 K33 K35 T44 V69 S71 P1 R2 E3 K25 K32 K34 T43 V68 S70
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0022618 protein-RNA complex assembly
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ove, PDBe:8ove, PDBj:8ove
PDBsum8ove
PubMed37985661
UniProtQ38FV6

[Back to BioLiP]