Structure of PDB 7nqh Chain Bp |
>7nqhBp (length=97) Species: 9823 (Sus scrofa) [Search protein sequence] |
AAALARLGLRAVKQVRVQFCPFEKNVESTRTFLQAVSSEKVRCTNLNCSV IADVRHDGSEPCVDVLFGDGHRLIMRGAHLTAQEMLTAFASHIQARG |
|
PDB | 7nqh Structural basis of translation termination, rescue, and recycling in mammalian mitochondria. |
Chain | Bp |
Resolution | 3.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
Bp |
A2 Q84 |
A1 Q83 |
|
|
|
|